Hemopexin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 86395-3-RR (same clone as 86395-3-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 86395-3-RR (HPX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86395-3-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 86395-3-RR (same clone as 86395-3-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 86395-3-RR (HPX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86395-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected CHO using 86395-3-RR (same clone as 86395-3-PBS)

  1x10^6 CHO cells or Transfected CHO cells were intracellularly stained with 0.25 ug Hemopexin Recombinant monoclonal antibody (86395-3-RR, Clone:250345E5) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 86395-3-PBS in a different storage buffer formulation.

Hemopexin Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 86395-3-PBS

Clone No.250345E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

HPX, Beta 1B glycoprotein, Beta-1B-glycoprotein

---

Product Information

86395-3-PBS targets Hemopexin in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3082

  Product name: Recombinant Human Hemopexin/HPX protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-462 aa of NM_000613.2

  Sequence: TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

• Full Name: hemopexin
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 65-75 kDa
• GenBank Accession Number: NM_000613.2
• Gene Symbol: Hemopexin
• Gene ID (NCBI): 3263
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02790
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Hemopexin (HPX) is the plasma protein responsible for scavenging heme, thus preventing heme-mediated oxidative stress and heme-bound iron loss. In addition, hemopexin blocks heme activation of immune receptors and vascular inflammatory processes. It is mainly expressed in liver, the synthesis of which is induced after inflammation. Alterations of plasma hemopexin level have been linked to disorders like atherosclerosis and inflammatory diseases.