Mouse Hif-1 alpha Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse kidney using 82989-6-RR (same clone as 82989-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 82989-6-RR (Hif-1 alpha antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82989-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 82989-6-RR (same clone as 82989-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 82989-6-RR (Hif-1 alpha antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82989-6-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 82989-6-RR (same clone as 82989-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Cobalt Chloride treated NIH/3T3 cells using Hif-1 alpha antibody (82989-6-RR, Clone: 230101B3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82989-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82989-6-RR

  Biolayer interferometry (BLl) kinetic assays of 82989-6-RR against Mouse Hif1a were performed. The affinity constant is 0.163 nM.

Hif-1 alpha Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 82989-6-PBS

Clone No.230101B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Hif1a, ARNT-interacting protein, Hif-1a, HIF1alpha, HIF-1-alpha

---

Product Information

82989-6-PBS targets Hif-1 alpha in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33620

  Product name: Recombinant mouse Hif1a protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-825 aa of NM_001313919

  Sequence: SEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQG*

• Full Name: hypoxia inducible factor 1, alpha subunit
• Calculated Molecular Weight: 93 kDa
• GenBank Accession Number: NM_001313919
• Gene Symbol: Hif1a
• Gene ID (NCBI): 15251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61221
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HIF1a, the major regulator of the cellular responses to hypoxia, consists of an oxygen-sensitive subunit, HIF1 alpha (HIF1A), and an oxygen-insensitive subunit, HIF1 beta (arylhydrocarbon receptor nuclear transporter [ARNT]). Under normal oxygen conditions, HIF1a is continuously produced and destroyed, in a process involving hydroxylation, interaction with von Hippel-Lindau (VHL) protein, polyubiquitylation and subsequent proteasomal degradation. Under hypoxic conditions, hydroxylation is impaired and HIF1a is stabilized. HIF1a localizes in cytoplasm in normoxia, but it can translocate into nuclear in response to hypoxia