Histone H1.0 Recombinant monoclonal antibody, PBS Only

• 

Histone H1.0 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83993-2-PBS

Clone No.241147D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

H1F0, H1 histone family, member 0, H10, H1-0, H1FV

---

Product Information

83993-2-PBS targets Histone H1.0 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9982

  Product name: Recombinant human Histone H1.0 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC000145

  Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

• Full Name: H1 histone family, member 0
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC000145
• Gene Symbol: Histone H1.0
• Gene ID (NCBI): 3005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07305
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.