Histone H1.0 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00895-1

  Sandwich ELISA standard curve of MP00895-1, Human Histone H1.0 Recombinant Matched Antibody Pair - PBS only. 83993-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag9982. 83993-1-PBS was HRP conjugated as the detection antibody. Range: 0.937-60 ng/mL

• 

  Sample test of MP00895-1

  Hela cell lysate was measured. The human Histone H1.0 concentration of detected samples was determined to be 385.31 ng/mL (based on a 2.0 mg/mL extract load).

• 

  Cytometric bead array standard curve of MP00895-1

  Cytometric bead array standard curve of MP00895-1, Histone H1.0 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83993-3-PBS. Detection antibody: 83993-1-PBS. Standard: Ag9982. Range: 0.781-100 ng/mL.

Histone H1.0 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83993-3-PBS

Clone No.241147F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

H1F0, H1 histone family, member 0, H10, H1-0, H1FV

---

Product Information

83993-3-PBS targets Histone H1.0 as part of a matched antibody pair:

MP00895-1: 83993-3-PBS capture and 83993-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9982

  Product name: Recombinant human Histone H1.0 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC000145

  Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

• Full Name: H1 histone family, member 0
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC000145
• Gene Symbol: Histone H1.0
• Gene ID (NCBI): 3005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07305
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.