Histone H2B Polyclonal antibody

• 

  WB analysis using 31048-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31048-1-AP (Histone H2B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

Histone H2B Polyclonal Antibody for WB, ELISA

Cat No. 31048-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

bA317E16.3, H2BFU, HIST1H2BA, histone cluster 1, H2ba, Histone H2B type 1 A, Histone H2B, testis, STBP, Testis specific histone H2B, TSH2B

---

Tested Applications

• Positive WB detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31048-1-AP targets Histone H2B in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33975

  Product name: Recombinant human HIST1H2BA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-127 aa of BC066242

  Sequence: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 1, H2ba
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC066242
• Gene Symbol: Histone H2B
• Gene ID (NCBI): 255626
• RRID: AB_3669832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96A08
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Histone H2BC1 is testis specific.