Histone H2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Histone H2B Polyclonal antibody (33612-1-AP)

• 

  WB analysis using 33612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33612-1-AP (HIST1H2BD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33612-1-AP (Histone H2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 33612-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33612-1-AP (Histone H2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Histone H2B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33612-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

H2B, H2B/a, H2B/g, H2B/h, H2B/k

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HSC-T6 cells, HeLa cells, NIH/3T3 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33612-1-AP targets Histone H2B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38954

  Product name: Recombinant human HIST1H2BD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of NM_021063.3

  Sequence: MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 1, H2bd
• Calculated Molecular Weight: 14kDa，126aa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_021063.3
• Gene Symbol: HIST1H2BD
• Gene ID (NCBI): 3017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P58876
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.