Histone H3.4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H3.4 Polyclonal antibody, PBS Only (18064-1-PBS)

• 

  WB analysis using 18064-1-AP (same clone as 18064-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18064-1-AP (Histone H3.4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18064-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 18064-1-AP (same clone as 18064-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18064-1-AP (Histone H3.4 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18064-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 18064-1-AP (same clone as 18064-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18064-1-AP (Histone H3.4 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18064-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 18064-1-AP (same clone as 18064-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 18064-1-AP (Histone H3.4 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18064-1-PBS in a different storage buffer formulation.

Histone H3.4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18064-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HIST3H3, H3.4, H3-4, H3FT, H3t

---

Product Information

18064-1-PBS targets Histone H3.4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12671

  Product name: Recombinant human HIST3H3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC101837

  Sequence: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA

• Full Name: histone cluster 3, H3
• Calculated Molecular Weight: 136 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC101837
• Gene Symbol: Histone H3.4
• Gene ID (NCBI): 8290
• RRID: AB_3669290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HIST3H3, also known as H3.1t and H3.4, is a histone H3 protein variant that bears the H3.1 variant hallmark cysteine 96 but includes three extra amino acid substitutions. H3.1t was found to be expressed in primary human spermatocytes at the pachytene stage, similar to the human testis-specific histone H1t variant, where it appears therefore to take part in the process of spermatogenesis (PMID: 21782046).