Hsc70 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81719-2-RR (same clone as 81719-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81719-2-RR (Hsc70 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81719-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 81719-2-RR (same clone as 81719-2-PBS)

  WB result of Hsc70 antibody (81719-2-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Hsc70 transfected HeLa cells. This data was developed using the same antibody clone with 81719-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Hsc70 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 81719-2-PBS

Clone No.3H9

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Heat shock 70 kDa protein 8, heat shock 70kDa protein 8, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, HSPA8, LAP1, NIP71

---

Product Information

81719-2-PBS targets Hsc70 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1018

  Product name: Recombinant human Hsc70 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 288-587 aa of BC007276

  Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

• Full Name: heat shock 70kDa protein 8
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007276
• Gene Symbol: HSC70
• Gene ID (NCBI): 3312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11142
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease. (PMID: 21832061)