• Featured Product
  • KD/KO Validated

Hsc70 Recombinant monoclonal antibody, PBS Only

Hsc70 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 81719-2-PBS
Clone No.3H9

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Heat shock 70 kDa protein 8, heat shock 70kDa protein 8, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, HSPA8, LAP1, NIP71

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81719-2-PBS targets Hsc70 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1018

Product name: Recombinant human Hsc70 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 288-587 aa of BC007276

Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

Predict reactive species
Full Name heat shock 70kDa protein 8
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC007276
Gene Symbol HSC70
Gene ID (NCBI) 3312
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11142
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease. (PMID: 21832061)

Loading...
||
New chat Able
正在加载,请稍候...