Huntingtin Monoclonal antibody, PBS Only

• 

  IHC staining of human cerebellum using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 66553-1-Ig (Huntingtin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 66553-1-Ig (Huntingtin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66553-1-Ig (Huntingtin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66553-1-Ig (Huntingtin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using Huntingtin antibody (66553-1-Ig, Clone: 2F6C9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), FUS/TLS antibody (11570-1-AP, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 66553-1-Ig (same clone as 66553-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Huntingtin antibody (66553-1-Ig, Clone: 2F6C9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66553-1-PBS in a different storage buffer formulation.

Huntingtin Monoclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 66553-1-PBS

Clone No.2F6C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

HTT, 2F6C9, HD, HD protein, Huntingtin, myristoylated N-terminal fragment

---

Product Information

66553-1-PBS targets Huntingtin in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25922

  Product name: Recombinant human Huntingtin protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 2845-3000 aa of NM_002111

  Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE

• Full Name: huntingtin
• Calculated Molecular Weight: 348 kDa
• GenBank Accession Number: NM_002111
• Gene Symbol: Huntingtin
• Gene ID (NCBI): 3064
• RRID: AB_2881915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P42858
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.