IBA1 Polyclonal antibody

• 

  IHC staining of rat brain using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 30523-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 30523-1-AP (IBA1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using 30523-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using IBA1 antibody (30523-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.

Cat No. 30523-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

AI607846, AIF 1, Aif1, D17H6S50E, G1, Iba1

---

Tested Applications

• Positive IHC detected in: rat brain tissue, mouse brain tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30523-1-AP targets IBA1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30575

  Product name: Recombinant mouse AIF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 86-147 aa of NM_019467

  Sequence: LKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

• Full Name: allograft inflammatory factor 1
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: NM_019467
• Gene Symbol: IBA1
• Gene ID (NCBI): 11629
• RRID: AB_3086348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O70200
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.