Tested Applications
| Positive WB detected in | THP-1 cells, U-937 cells, HL-60 cells |
| Positive IHC-Autostainer detected in | human tonsil tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue, human liver tissue, human tonsil tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive FC (Intra) detected in | THP-1 cells |
This antibody is not recommended for frozen sections.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:50-1:500 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
| IF | See 6 publications below |
Product Information
81728-1-RR targets IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species |
| Full Name | allograft inflammatory factor 1 |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC009474 |
| Gene Symbol | IBA1 |
| Gene ID (NCBI) | 199 |
| ENSEMBL Gene ID | ENSG00000204472 |
| RRID | AB_2935574 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55008 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IF protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IHC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| WB protocol for IBA1 antibody 81728-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Antioxidants (Basel) Withania somnifera (Ashwagandha) Improves Spatial Memory, Anxiety and Depressive-like Behavior in the 5xFAD Mouse Model of Alzheimer's Disease | ||
Adv Mater Biomimetic Nanomotors for Deep Ischemia Penetration and Ferroptosis Inhibition in Neuroprotective Therapy of Ischemic Stroke | ||
Neural Regen Res Changes in border-associated macrophages after stroke: single-cell sequencing analysis | ||
Exp Cell Res Targeting of ubiquitination and degradation of KLF15 by E3 ubiquitin ligase KBTBD7 regulates LPS-induced septic brain injury in microglia | ||
CNS Neurosci Ther A Novel Compound Ligusticum Cycloprolactam Alleviates Neuroinflammation After Ischemic Stroke via the FPR1/NLRP3 Signaling Axis | ||
Brain Behav The Activation of PKM2 Induces Pyroptosis in Hippocampal Neurons via the NLRP3/Caspase-1/GSDMD Pathway in Neonatal Rats With Hypoxic-Ischemic Brain Injury |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kateryna (Verified Customer) (01-23-2025) | IBA1 was used as a microglial-specific marker to visualize microglia in mouse brain tissue, specifically the cortex. The antibody worked consistently well on the fixed tissue: 40-μm thick sections, 3% normal goat serum blocking, and overnight incubation with the antibody (IBA1). In the image, red represents IBA1 visualized by an Alexa 633-labeled anti-rabbit fluorescent secondary antibody.
![]() |


































