IBA1 Recombinant monoclonal antibody, PBS Only

• 

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.

Cat No. 81728-3-PBS

Clone No.242712D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

AIF1, AIF 1, AIF-1, allograft inflammatory factor 1, G1

---

Product Information

81728-3-PBS targets IBA1 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1363

  Product name: Recombinant human IBA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC009474

  Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

• Full Name: allograft inflammatory factor 1
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC009474
• Gene Symbol: IBA1
• Gene ID (NCBI): 199
• ENSEMBL Gene ID: ENSG00000204472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55008
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.