Tested Applications
Positive IF-P detected in | human spleen tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-67014 targets ICAM4 in IF-P applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
Full Name | intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) |
Calculated Molecular Weight | 271 aa, 29 kDa |
GenBank Accession Number | BC029364 |
Gene Symbol | ICAM4 |
Gene ID (NCBI) | 3386 |
RRID | AB_2919405 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q14773 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 ICAM4 antibody CL488-67014 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |