ICK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ICK Polyclonal antibody, PBS Only (29728-1-PBS)

• 

  IP experiment of PC-3 using 29728-1-AP (same clone as 29728-1-PBS)

  IP result of anti-ICK (IP:29728-1-AP, 4ug; Detection:29728-1-AP 1:400) with PC-3 cells lysate 1575 ug. This data was developed using the same antibody clone with 29728-1-PBS in a different storage buffer formulation.

ICK Polyclonal Antibody for IP, Indirect ELISA

Cat No. 29728-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, Indirect ELISA

Synonyms

---

Product Information

29728-1-PBS targets ICK in IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30240

  Product name: Recombinant human ICK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 286-495 aa of BC136420

  Sequence: VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRY

• Full Name: intestinal cell (MAK-like) kinase
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC136420
• Gene Symbol: ICK
• Gene ID (NCBI): 22858
• RRID: AB_3669694
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPZ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ICK is involved in the control of ciliary length, it may play a key role in the development of multiple organ systems and particularly in cardiac development.