Product Information
98214-1-PBS targets ICOS/CD278 in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1642 Product name: recombinant human ICOS protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC028210 Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK Predict reactive species |
| Full Name | inducible T-cell co-stimulator |
| Calculated Molecular Weight | 199 aa, 23 kDa |
| GenBank Accession Number | BC028210 |
| Gene Symbol | ICOS |
| Gene ID (NCBI) | 29851 |
| RRID | AB_3745881 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y6W8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.
