ID2 Polyclonal antibody

• 

  WB analysis using 12502-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12502-1-AP (ID2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ID2 Polyclonal Antibody for WB, ELISA

Cat No. 12502-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bHLHb26, Class B basic helix-loop-helix protein 26, DNA-binding protein inhibitor ID-2

---

Tested Applications

• Positive WB detected in: A-673 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12502-1-AP targets ID2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3179

  Product name: Recombinant human ID2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC030639

  Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

• Full Name: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC030639
• Gene Symbol: ID2
• Gene ID (NCBI): 3398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02363
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.