Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, LNCaP cells, mouse liver tissue, rat liver tissue |
Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
81176-1-RR targets IDH1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species |
Full Name | isocitrate dehydrogenase 1 (NADP+), soluble |
Calculated Molecular Weight | 414 aa, 47 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC012846 |
Gene Symbol | IDH1 |
Gene ID (NCBI) | 3417 |
RRID | AB_2923706 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O75874 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IDH1 antibody 81176-1-RR | Download protocol |
IHC protocol for IDH1 antibody 81176-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |