IDH1 Recombinant monoclonal antibody

• 

  WB analysis using 81176-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81176-1-RR (IDH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 81176-1-RR

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 81176-1-RR (IDH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 81176-1-RR

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 81176-1-RR (IDH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 81176-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IDH1 Recombinant antibody (81176-1-RR, Clone:6L18) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 81176-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81176-1-RR against Human IDH1 were performed. The affinity constant is 17.5 pM.

IDH1 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 81176-1-RR

Clone No.6L18

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

6L18, Cytosolic NADP-isocitrate dehydrogenase, EC:1.1.1.42, IDCD, IDH

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81176-1-RR targets IDH1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19749

  Product name: Recombinant human IDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-414 aa of BC012846

  Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

• Full Name: isocitrate dehydrogenase 1 (NADP+), soluble
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC012846
• Gene Symbol: IDH1
• Gene ID (NCBI): 3417
• RRID: AB_2923706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).