Use Able AI chat for product recommendations

CoraLite® Plus 750-conjugated IDH1 Recombinant monoclonal antibody

IDH1 Uni-rAb® Recombinant Antibody for WB, FC (Intra)

Cat No. CL750-81176
Clone No.6L18

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

6L18, Cytosolic NADP-isocitrate dehydrogenase, EC:1.1.1.42, IDCD, IDH

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue, LNCaP cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81176 targets IDH1 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19749

Product name: Recombinant human IDH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 341-414 aa of BC012846

Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

Predict reactive species
Full Name isocitrate dehydrogenase 1 (NADP+), soluble
Calculated Molecular Weight 414 aa, 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC012846
Gene Symbol IDH1
Gene ID (NCBI) 3417
RRIDAB_3673725
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75874
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 IDH1 antibody CL750-81176Download protocol
WB protocol for CL Plus 750 IDH1 antibody CL750-81176Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...