Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue, LNCaP cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-81176 targets IDH1 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species |
| Full Name | isocitrate dehydrogenase 1 (NADP+), soluble |
| Calculated Molecular Weight | 414 aa, 47 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC012846 |
| Gene Symbol | IDH1 |
| Gene ID (NCBI) | 3417 |
| RRID | AB_3673725 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O75874 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 750 IDH1 antibody CL750-81176 | Download protocol |
| WB protocol for CL Plus 750 IDH1 antibody CL750-81176 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



