IDH3B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IDH3B Polyclonal antibody (15576-1-AP)

• 

  WB analysis using 15576-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15576-1-AP (IDH3B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15576-1-AP (IDH3B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15576-1-AP (IDH3B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 15576-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using IDH3B antibody (15576-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 15576-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using IDH3B antibody (15576-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

IDH3B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15576-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

H IDHB, NAD(+)-specific ICDH subunit beta, RP46

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, Jurkat cells, LNCaP cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15576-1-AP targets IDH3B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7965

  Product name: Recombinant human IDH3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-385 aa of BC001960

  Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS

• Full Name: isocitrate dehydrogenase 3 (NAD+) beta
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC001960
• Gene Symbol: IDH3B
• Gene ID (NCBI): 3420
• RRID: AB_3741868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43837
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Isocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633).