Use Able AI chat for product recommendations

IDH3B Monoclonal antibody, PBS Only

IDH3B Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68199-1-PBS
Clone No.2D11A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Rabbit, Pig

Applications

WB, Indirect ELISA

FLJ11043, H IDHB, IDH3B, RP46

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68199-1-PBS targets IDH3B in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

Tested Reactivity Human, Mouse, Rat, Rabbit, Pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8693

Product name: Recombinant human IDH3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-385 aa of BC001960

Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS

Predict reactive species
Full Name isocitrate dehydrogenase 3 (NAD+) beta
Calculated Molecular Weight 42 kDa
Observed Molecular Weight39-42 kDa
GenBank Accession NumberBC001960
Gene Symbol IDH3B
Gene ID (NCBI) 3420
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43837
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Isocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633).

Loading...
||
New chat

Able

正在加载,请稍候...