IDH3B Monoclonal antibody, PBS Only

• 

  WB analysis using 68199-1-Ig (same clone as 68199-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68199-1-Ig (IDH3B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68199-1-PBS in a different storage buffer formulation.

IDH3B Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68199-1-PBS

Clone No.2D11A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Rabbit, Pig

Applications

WB, Indirect ELISA

Synonyms

FLJ11043, H IDHB, IDH3B, RP46

---

Product Information

68199-1-PBS targets IDH3B in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8693

  Product name: Recombinant human IDH3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-385 aa of BC001960

  Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS

• Full Name: isocitrate dehydrogenase 3 (NAD+) beta
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 39-42 kDa
• GenBank Accession Number: BC001960
• Gene Symbol: IDH3B
• Gene ID (NCBI): 3420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43837
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Isocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633).