IDI1 Polyclonal antibody

• 

  WB analysis of L02 using 11166-2-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11166-2-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11166-2-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 11166-2-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 11166-2-AP

  IP result of anti-IDI1 (IP:11166-2-AP, 4ug; Detection:11166-2-AP 1:300) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of human colon cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IDI1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11166-2-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

IDI1, IPP isomerase 1, IPP1, IPPI1

---

Tested Applications

• Positive WB detected in: L02 cells, human liver tissue, mouse liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below

Product Information

11166-2-AP targets IDI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1636

  Product name: Recombinant human IDI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC019227

  Sequence: VLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDTLGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM

• Full Name: isopentenyl-diphosphate delta isomerase 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC019227
• Gene Symbol: IDI1
• Gene ID (NCBI): 3422
• RRID: AB_2233532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13907
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDI1(Isopentenyl-diphosphate Delta-isomerase 1) is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP). It belongs to the IPP isomerase type 1 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 26 kDa and 32 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuron; Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.; Authors - Xiaohui Li
human	WB	PLoS One; Timosaponin AIII is preferentially cytotoxic to tumor cells through inhibition of mTOR and induction of ER stress.; Authors - King Frank W FW
mouse	WB	Curr Issues Mol Biol; Gigantol Improves Cholesterol Metabolism and Progesterone Biosynthesis in MA-10 Leydig Cells.; Authors - Audrey Basque
human	WB	Proteomes; Utilizing Optimized Tools to Investigate PTM Crosstalk: Identifying Potential PTM Crosstalk of Acetylated Mitochondrial Proteins.; Authors - Henrick Horita
mouse	WB	Toxicol In Vitro; Sinapic and ferulic acid phenethyl esters increase the expression of steroidogenic genes in MA-10 tumor Leydig cells; Authors - Audrey Basque
mouse	WB	Elife; TEAD1 is crucial for developmental myelination, Remak bundles, and functional regeneration of peripheral nerves; Authors - Matthew Grove

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kishor (Verified Customer) (12-20-2020)

working good for IHC at 1;200 dilution

• Applications: Immunohistochemistry
• Cell Tissue Type: mouse liver tissues and rat liver