IDI1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IDI1 Polyclonal antibody (11166-2-AP)

IDI1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11166-2-AP Copied!

Publications (10)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

EC:5.3.3.2, IPP1, IPPI1, Isopentenyl-diphosphate Delta-isomerase 1

• 

  WB analysis of L02 using 11166-2-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 11166-2-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 11166-2-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11166-2-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11166-2-AP (IDI1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 11166-2-AP

  IP result of anti-IDI1 (IP:11166-2-AP, 4ug; Detection:11166-2-AP 1:300) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11166-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11166-2-AP (IDI1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IDI1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, human liver tissue, mouse liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11166-2-AP targets IDI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1636

  Product name: Recombinant human IDI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC019227

  Sequence: VLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDTLGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM

• Full Name: isopentenyl-diphosphate delta isomerase 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC019227
• Gene Symbol: IDI1
• Gene ID (NCBI): 3422
• RRID: AB_2233532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13907
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDI1(Isopentenyl-diphosphate Delta-isomerase 1) is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP). It belongs to the IPP isomerase type 1 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 26 kDa and 32 kDa.

Publications

What published studies show

The IDI1 polyclonal antibody (Cat# 11166-2-AP) has 10 citations published in journals including Neuron, International Journal of Biological Sciences, Proteomes, Current Issues in Molecular Biology, Molecular and Cellular Endocrinology, PLoS ONE, Toxicology in Vitro, and eLife. Research fields span cholesterol metabolism, melanoma proliferation, acetylated mitochondrial protein crosstalk, steroidogenesis and progesterone biosynthesis, mTOR/ER stress signaling, alcohol-associated liver disease, and peripheral nerve myelination.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuron; Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.; Authors - Xiaohui Li
human	WB	Int J Biol Sci; The SOX10-ACAT2-Cholesterol Synthesis Axis Is Required for Melanoma Proliferation.; Authors - Lihua Wang
human	WB	Proteomes; Utilizing Optimized Tools to Investigate PTM Crosstalk: Identifying Potential PTM Crosstalk of Acetylated Mitochondrial Proteins.; Authors - Henrick Horita
mouse	WB	Curr Issues Mol Biol; Gigantol Improves Cholesterol Metabolism and Progesterone Biosynthesis in MA-10 Leydig Cells.; Authors - Audrey Basque
mouse	WB	Mol Cell Endocrinol; High concentrations of progesterone inhibit the expression of genes related to steroid metabolism in MA-10 Leydig cells; Authors - Liel-Sarah Izichkis
mouse	WB	Mol Cell Endocrinol; SP600125 decreases cAMP/PKA-dependent steroid production through ATF4/DDIT3 activation in MA-10 Leydig cells; Authors - Audrey Basque

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

One user rated this antibody 4 out of 5 stars. They used it for immunohistochemistry at a 1:200 dilution on mouse and rat liver tissues and reported that it worked well. Overall, the limited feedback suggests reliable performance for IHC applications on liver samples.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Kishor (Verified Customer) (12-20-2020)

working good for IHC at 1;200 dilution

• Applications: Immunohistochemistry
• Cell Tissue Type: mouse liver tissues and rat liver