IDUA Polyclonal antibody

IDUA Polyclonal Antibody for WB, IHC, ELISA
Cat No. 30006-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, rat

Applications

WB, IHC, ELISA

Alpha L iduronidase, IDA, IDUA, iduronidase, alpha L, MPS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, LNCaP cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30006-1-AP targets IDUA in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.

Tested Reactivity Human, Mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30658

Product name: Recombinant human IDUA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 441-555 aa of NM_000203

Sequence: YASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLR

Predict reactive species
Full Name iduronidase, alpha-L-
Calculated Molecular Weight 73 kDa
Observed Molecular Weight73 kDa
GenBank Accession NumberNM_000203
Gene Symbol IDUA
Gene ID (NCBI) 3425
RRIDAB_2935498
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35475
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Iduronidase (L-iduronidase, alpha-L-iduronidase, laronidase) is an enzyme with the systematic name glycosaminoglycan alpha-L-iduronohydrolase. This enzyme catalyzes the hydrolysis of unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. It is a glycoprotein enzyme found in the lysosomes of cells. It is involved in the degeneration of glycosaminoglycans such as dermatan sulfate and heparan sulfate. The enzyme acts by hydrolyzing the terminal alpha-L-iduronic acid residues of these molecules, degrading them (PMID: 4993544,30407). A deficiency in the IDUA protein is associated with mucopolysaccharidoses (MPS). MPS, a type of lysosomal storage disease, is typed I through VII. In this syndrome, glycosaminoglycans accumulate in the lysosomes and cause substantial disease in many different tissues of the body. IDUA mutations result in the MPS 1 phenotype, which is inherited in an autosomal recessive fashion. The defective alpha-L-iduronidase results in an accumulation of heparan and dermatan sulfate within phagocytes, endothelium, smooth muscle cells, neurons, and fibroblasts. Prenatal diagnosis of this enzyme deficiency is possible (PMID:8242073).

Protocols

Product Specific Protocols
IHC protocol for IDUA antibody 30006-1-APDownload protocol
WB protocol for IDUA antibody 30006-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Poult Sci

Exploring ANT1 dysfunction as a pathological driver of wooden breast myopathy in broiler chickens

Authors - Bolin Zhong
Loading...
||
New chat

Able

正在加载,请稍候...