Product Information
29402-1-PBS targets IER3IP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28027 Product name: Recombinant human IER3IP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC010888 Sequence: MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG Predict reactive species |
| Full Name | immediate early response 3 interacting protein 1 |
| Calculated Molecular Weight | 82 aa, 9 kDa |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC010888 |
| Gene Symbol | IER3IP1 |
| Gene ID (NCBI) | 51124 |
| RRID | AB_2918295 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5U9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





