IFFO1 Polyclonal antibody

IFFO1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16041-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Tumor antigen HOM-TES-103, Non-homologous end joining factor IFFO1, NHEJ factor IFFO1, IFFO, HOM TES 103

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, mouse testis tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHela cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

16041-1-AP targets IFFO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8915

Product name: Recombinant human IFFO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 94-294 aa of BC004384

Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Predict reactive species
Full Name intermediate filament family orphan 1
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC004384
Gene Symbol IFFO1
Gene ID (NCBI) 25900
RRIDAB_2121676
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ0D2I5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFFO1, also named as IFFO and Tumor antigen HOM-TES-103, is a member of the intermediate filament family which consists of primordial components of the cytoskeleton and nuclear envelope that are mainly distributed in the nucleus, followed by the cytoskeleton and cytoplasm. IFFO1 in the nucleus was identified to combine with both XRCC4 and the nuclear lamina protein lamin A/C to be involved in nonhomologous DNA end joining (NHEJ). The expression of IFFO1 is associated with tumor progression. IFFO1 could be used as a potential marker to differentiate malignant ascites cell-free tumor DNA (cftDNA) of ovarian cancer from benign controls.

Protocols

Product Specific Protocols
WB protocol for IFFO1 antibody 16041-1-APDownload protocol
IHC protocol for IFFO1 antibody 16041-1-APDownload protocol
IF protocol for IFFO1 antibody 16041-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancer Lett

METTL3-mediated N6-methyladenosine modification and HDAC5/YY1 promote IFFO1 downregulation in tumor development and chemo-resistance

Authors - Ye Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shinford (Verified Customer) (10-26-2023)

It's essential to exercise caution while cutting the membrane as the bands appeared very close to the 70kDa line. In my case, I experienced the loss of some bands, possibly due to the cut being too close to the border.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Cancer cell lines
FH

Maria Jose (Verified Customer) (09-28-2020)

The antibody is very unspecific. There are many bands in the western blot. It recognizes GST with very high affinity.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human
Loading...
||
New chat Able
正在加载,请稍候...