Tested Applications
| Positive WB detected in | COLO 320 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11597-1-AP targets IFI30 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2178 Product name: Recombinant human IFI30 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC021136 Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK Predict reactive species |
| Full Name | interferon, gamma-inducible protein 30 |
| Calculated Molecular Weight | 261 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC021136 |
| Gene Symbol | IFI30 |
| Gene ID (NCBI) | 10437 |
| RRID | AB_2121789 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13284 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFI30 antibody 11597-1-AP | Download protocol |
| IHC protocol for IFI30 antibody 11597-1-AP | Download protocol |
| IP protocol for IFI30 antibody 11597-1-AP | Download protocol |
| WB protocol for IFI30 antibody 11597-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-IFI30 antibody (Cat# 11597-1-AP) has 10 citations published in journals including Phytomedicine, Frontiers in Immunology, American Journal of Physiology, Translational Oncology, Cancer Innovation, International Journal of Medical Sciences, IUBMB Life, Thoracic Cancer, Recent Patents on Anticancer Drug Discovery, and Aging. Research fields span gastric cancer, liver fibrosis, renal cell carcinoma, breast cancer, cervical cancer, esophageal cancer, and macrophage biology.
| Species | Application | Title |
|---|---|---|
Phytomedicine Nobiletin inhibits de novo FA synthesis to alleviate gastric cancer progression by regulating endoplasmic reticulum stress | ||
Front Immunol TIGIT impairs NK cell antifibrotic activity through the IFNγ-IFI30 axis in schistosomiasis-induced liver fibrosis. | ||
Am J Physiol Cell Physiol CFTR and PC2, partners in the primary cilia in autosomal dominant polycystic kidney disease | ||
Transl Oncol Decoding macrophage-driven tumor heterogeneity in renal cell carcinoma using spatial and single-cell transcriptomics. | ||
Cancer Innov Investigating the Mechanism of IFN-γ-Inducible Lysosomal Thiol Reductase-Mediated Inhibition of Breast Cancer Cell Proliferation
| ||
Int J Med Sci IFI30 expression predicts patient prognosis in breast cancer and dictates breast cancer cells proliferation via regulating autophagy.
|
