IFI44 Monoclonal antibody, PBS Only

• 

  WB analysis using 68575-1-Ig (same clone as 68575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68575-1-Ig (IFI44 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68575-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68575-1-Ig (same clone as 68575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68575-1-Ig (IFI44 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68575-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68575-1-Ig (same clone as 68575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68575-1-Ig (IFI44 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68575-1-PBS in a different storage buffer formulation.

IFI44 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68575-1-PBS

Clone No.3A2A11

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

IFI44, interferon induced protein 44, MTAP44, p44

---

Product Information

68575-1-PBS targets IFI44 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33799

  Product name: Recombinant human IFI44 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 9-175 aa of BC022870

  Sequence: RLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALR

• Full Name: interferon-induced protein 44
• Calculated Molecular Weight: 444 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC022870
• Gene Symbol: IFI44
• Gene ID (NCBI): 10561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8TCB0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.