IFIH1/MDA5 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IFIH1/MDA5 Recombinant monoclonal antibody (87135-1-RR)

• 

  WB analysis using 87135-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87135-1-RR (IFIH1/MDA5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87135-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87135-1-RR against Human IFIH1 were performed. The affinity constant is 5.16 nM.

IFIH1/MDA5 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87135-1-RR

Clone No.252265E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IFIH1, MDA5, CADM-140 autoantigen, Clinically amyopathic dermatomyositis autoantigen 140 kDa, EC:3.6.4.13

---

Tested Applications

• Positive WB detected in: THP-1 cells, Jurkat cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87135-1-RR targets IFIH1/MDA5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16467

  Product name: Recombinant human IFIH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-310 aa of BC111750

  Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRP

• Full Name: interferon induced with helicase C domain 1
• Calculated Molecular Weight: 1025 aa, 117 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC111750
• Gene Symbol: IFIH1
• Gene ID (NCBI): 64135
• RRID: AB_3745364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYX4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFIH1 (Interferon-induced helicase C domain-containing protein 1) is a putative RNA helicase that is upregulated in response to treatment with IFNB or IFNB and MEZ. It is also named as MDA5 and RH116. Ectopic expression of MDA5 in melanoma cells resulted in reduced colony formation, suggesting an interaction of the CARD and apoptotic signal molecules. Functional analysis indicated that MDA5 is an RNA-dependent ATPase. IFIH1 has an apparent molecular mass of 117-130 kDa, and always other bands (70 kDa and 90 kDa) can be detected as cleaved products (PMID: 17267501). This antibody is specific to IFIH1.