IFIT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IFIT1 Polyclonal antibody, PBS Only (29897-1-PBS)

• 

  WB analysis using 29897-1-AP (same clone as 29897-1-PBS)

  untreated and IFN alpha treated HeLa cells were subjected to SDS PAGE followed by western blot with 29897-1-AP (IFIT1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29897-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29897-1-AP (same clone as 29897-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29897-1-AP (IFIT1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29897-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29897-1-AP (same clone as 29897-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29897-1-AP (IFIT1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29897-1-PBS in a different storage buffer formulation.

IFIT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29897-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

IFIT-1, IFIT 1, IFI-56K, IFI56, IFI 56K

---

Product Information

29897-1-PBS targets IFIT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31980

  Product name: Recombinant human IFIT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 390-460 aa of BC007091

  Sequence: FQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY

• Full Name: interferon-induced protein with tetratricopeptide repeats 1
• Calculated Molecular Weight: 478 aa, 55 kDa
• Observed Molecular Weight: 55 KDa
• GenBank Accession Number: BC007091
• Gene Symbol: IFIT1
• Gene ID (NCBI): 3434
• RRID: AB_3669699
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09914
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication.