IFITM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IFITM1 Polyclonal antibody (11727-3-AP)

• Featured Product
• KD/KO Validated

IFITM1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11727-3-AP Copied!

Publications (35)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

9 27, 927, CD225, Dispanin subfamily A member 2a, DSPA2a

• 

  WB analysis of HepG2 using 11727-3-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11727-3-AP (IFITM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11727-3-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11727-3-AP (IFITM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11727-3-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11727-3-AP (IFITM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of ROS1728 using 11727-3-AP

  IP result of anti-IFITM1 (IP:11727-3-AP, 4ug; Detection:11727-3-AP 1:500) with ROS1728 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 11727-3-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11727-3-AP (IFITM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 11727-3-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11727-3-AP (IFITM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11727-3-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11727-3-AP (IFITM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11727-3-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11727-3-AP (IFITM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IFITM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, TF-1 cells
• Positive IP detected in: ROS1728 cells
• Positive IHC detected in: human lymphoma tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11727-3-AP targets IFITM1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, pig, goat, african green monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2320

  Product name: Recombinant human IFITM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC000897

  Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

• Full Name: interferon induced transmembrane protein 1 (9-27)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC000897
• Gene Symbol: IFITM1
• Gene ID (NCBI): 8519
• RRID: AB_2122083
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13164
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFITM1(interferon induced transmembrane protein), also named DSPA2a or interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection.

Publications

What published studies show

The IFITM1 Polyclonal antibody (Cat# 11727-3-AP) has 35 citations spanning journals including Nature, Nature Immunology, Nature Communications, Cell Reports, Hepatology, Journal of Virology, PLoS Pathogens, Oncogene, and Molecular Therapy. Research fields cover antiviral immunity, interferon-stimulated gene regulation, viral restriction (HIV, hepatitis, Ebola, coronavirus), cancer biology, innate immune signaling, and proteomics. Applications are predominantly Western blot, with some IHC and IF.

Automatically generated from the 35 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Nature; Intrinsic retroviral reactivation in human preimplantation embryos and pluripotent cells.; Authors - Edward J Grow ; KD Validated
human	WB	Nature; Mitotic progression following DNA damage enables pattern recognition within micronuclei.; Authors - Shane M Harding
human	WB	Nat Immunol; Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity.; Authors - Li Jianhua J
human	WB	Nat Commun; IFITM3 restricts virus-induced inflammatory cytokine production by limiting Nogo-B mediated TLR responses; Authors - M. Clement
human	WB,IF	Hepatology; IFITMs mediate viral evasion in acute and chronic hepatitis C virus infection.; Authors - Florian Wrensch
human	WB	Cell Rep Med; Therapeutic stress triggers tumor STAT1 acetylation to disarm immunotherapy.; Authors - Po-Hsien Chiu