IFN Alpha Monoclonal antibody, PBS Only

IFN Alpha Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66162-1-PBS
Clone No.4A2A11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, Indirect ELISA

IFL, IFN, IFN ALPHA, IFN alpha 1/13, IFNA@, IFNA1, IFNA13, IFN-alpha, LeIF D

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66162-1-PBS targets IFN Alpha in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12533

Product name: Recombinant human IFNA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-189 aa of BC074928

Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Predict reactive species
Full Name IFNA1
Calculated Molecular Weight 189 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC074928
Gene Symbol IFN alpha1
Gene ID (NCBI) 3439
RRIDAB_2881558
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01562
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IFNA1 (IF-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFNA1 induces B cell maturation into plasma cells and immunoglobulin production. IFNA1 plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFNA1 was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer.

Loading...
||
New chat Able
正在加载,请稍候...