Anti-Human IFN-gamma Rabbit Recombinant Antibody, PBS Only

IFN-gamma Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98187-1-PBS
Clone No.241390B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IFNG, 241390B10, IFG, IFN gamma, IFN γ

Formulation:  PBS Only
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98187-1-PBS targets IFN-gamma in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0004

Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 24-161 aa of BC070256

Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Predict reactive species
Full Name IFN gamma
Calculated Molecular Weight 166 aa, 19 kDa
GenBank Accession NumberBC070256
Gene Symbol IFNG
Gene ID (NCBI) 3458
ENSEMBL Gene IDENSG00000111537
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP01579
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)

Loading...
||
New chat

Able

正在加载,请稍候...