Tested Applications
Positive FC (Intra) detected in | PMA and ionomycin treated human PBMCs |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension |
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL647-98187 targets IFN-gamma in FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0004 Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 24-161 aa of BC070256 Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species |
Full Name | IFN gamma |
Calculated Molecular Weight | 166 aa, 19 kDa |
GenBank Accession Number | BC070256 |
Gene Symbol | IFNG |
Gene ID (NCBI) | 3458 |
ENSEMBL Gene ID | ENSG00000111537 |
Conjugate | CoraLite® Plus 647 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P01579 |
Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 647 IFN-gamma antibody CL647-98187 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |