FITC Plus Anti-Human IFN-gamma Rabbit Recombinant Antibody

IFN-gamma Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. FITC-98187
Clone No.241390B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IFNG, 241390B10, IFG, IFN gamma, IFN γ

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inPMA and ionomycin treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98187 targets IFN-gamma in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0004

Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 24-161 aa of BC070256

Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Predict reactive species
Full Name IFN gamma
Calculated Molecular Weight 166 aa, 19 kDa
GenBank Accession NumberBC070256
Gene Symbol IFNG
Gene ID (NCBI) 3458
ENSEMBL Gene IDENSG00000111537
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01579
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)

Protocols

Product Specific Protocols
FC protocol for FITC Plus IFN-gamma antibody FITC-98187Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...