IFN-gamma Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IFN-gamma Polyclonal antibody (15365-1-AP)

• Featured Product
• KD/KO Validated

IFN-gamma Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15365-1-AP Copied!

Publications (163)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

IFNG, IFG, IFN gamma, IFN γ, IFNγ

• 

  WB analysis using 15365-1-AP

  PMA, Ionomycin and Brefeldin A treated NK-92 cells were subjected to SDS PAGE followed by western blot with 15365-1-AP (IFN Gamma antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Recombinant protein using 15365-1-AP

  Recombinant human IFN gamma protein (cat.NO. HZ-1301) were subjected to SDS PAGE followed by western blot with 15365-1-AP (IFN gamma antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 15365-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 15365-1-AP (IFN Gamma antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IFN-gamma in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NK-92 cells, Recombinant protein
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15365-1-AP targets IFN-gamma in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8321

  Product name: Recombinant human IFNG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-166 aa of BC070256

  Sequence: YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

• Full Name: IFN gamma
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC070256
• Gene Symbol: IFNG
• Gene ID (NCBI): 3458
• ENSEMBL Gene ID: ENSG00000111537
• RRID: AB_2123037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01579
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFN gamma (IFNG) is a soluble cytokine that is the only member of the type II class of IFN. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia.

Publications

What published studies show

The IFN-gamma Polyclonal antibody (Cat# 15365-1-AP) has accumulated 163 citations. Publications span high-impact journals including Science, Nature Immunology, Nature Communications, Gastroenterology, Cancer Research, Signal Transduction and Targeted Therapy, Molecular Cancer, Advanced Science, Cell Reports, and Frontiers in Immunology. Research fields encompass cancer immunotherapy, inflammatory and autoimmune diseases, fibrosis, infectious diseases, neuroinflammation, wound healing, reproductive immunology, and macrophage/T-cell biology. Primary applications include WB, IHC, IF, and ELISA across human, mouse, rat, and pig species, reflecting broad utility in both basic and translational immunology research.

Automatically generated from the 163 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Signal Transduct Target Ther; Corynebacterium parakroppenstedtii secretes a novel glycolipid to promote the development of granulomatous lobular mastitis; Authors - Ran Liu
human	IHC	J Hematol Oncol; PD-1 axis expression in musculoskeletal tumors and antitumor effect of nivolumab in osteosarcoma model of humanized mouse.; Authors - Bingxin Zheng
	IF	Science; Aberrant hyperexpression of the RNA binding protein FMRP in tumors mediates immune evasion; Authors - Qiqun Zeng
	IHC	Mol Cancer; The construction of modular universal chimeric antigen receptor T (MU-CAR-T) cells by covalent linkage of allogeneic T cells and various antibody fragments; Authors - Tao Chen
human	IF	Gastroenterology; Interferon-γ-stimulated genes, but not USP18, are expressed in livers of patients with acute hepatitis C.; Authors - Michael T Dill
human	IF	Nat Immunol; Targeting regulator of G protein signaling 1 in tumor-specific T cells enhances their trafficking to breast cancer.; Authors - Di Huang