Tested Applications
| Positive WB detected in | Human testis, tissue |
| Positive IP detected in | PC-3 cells |
| Positive IHC detected in | human kidney tissue, human heart tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60227-1-Ig targets IFT88 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species |
| Full Name | intraflagellar transport 88 homolog (Chlamydomonas) |
| Calculated Molecular Weight | 94 kDa |
| Observed Molecular Weight | 88-95 kDa |
| GenBank Accession Number | BC030776 |
| Gene Symbol | IFT88 |
| Gene ID (NCBI) | 8100 |
| RRID | AB_11042449 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13099 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IFT88 antibody 60227-1-Ig | Download protocol |
| IP protocol for IFT88 antibody 60227-1-Ig | Download protocol |
| WB protocol for IFT88 antibody 60227-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IFT88 Monoclonal antibody (Cat# 60227-1-Ig) has 12 citations published in journals including J Adv Res, Sci Adv, Front Cell Dev Biol, Molecules, Oncol Rep, Front Mol Biosci, Mol Hum Reprod, J Cell Physiol, Cell Cycle, Exp Eye Res, and bioRxiv. Research fields span intraflagellar transport and ciliary biology, cell quiescence, chondrogenesis, inflammation, non-small cell lung cancer, Alzheimer's disease, spermiogenesis, skeletal muscle atrophy, osteoblast signaling, and photoreceptor ciliary defects.
| Species | Application | Title |
|---|---|---|
J Adv Res Ciliary IFT88 inhibits intervertebral disc degeneration under excessive mechanical stress by regulating endplate cartilage calcification | ||
Sci Adv Synchronized temporal-spatial analysis via microscopy and phosphoproteomics (STAMP) of quiescence | ||
Front Cell Dev Biol Microtubule Stabilization Enhances the Chondrogenesis of Synovial Mesenchymal Stem Cells. | ||
Molecules 2-IPMA Ameliorates PM2.5-Induced Inflammation by Promoting Primary Ciliogenesis in RPE Cells
| ||
Oncol Rep Inhibition of primary ciliogenesis enhances efficacy of EGFR‑TKIs against non‑small cell lung cancer cells.
| ||
Front Mol Biosci Primary cilia-mediated regulation of microglial secretion in Alzheimer's disease
|
Reviews
What customers say
The single review for this product rates it 4 out of 5 stars. The reviewer used it for Western Blot on HePG2 and Hela cells at a 1:500 dilution, with an overnight incubation in TBST plus 5% BSA. Overall, the feedback is positive, indicating the antibody performed well in WB applications under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
k (Verified Customer) (10-26-2023) | I used it with TBST+5% BSA over night for WB analysis.
 |
