IGF2BP2 Recombinant monoclonal antibody, PBS Only

IGF2BP2 Uni-rAb® Recombinant Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 82757-2-PBS
Clone No.6L8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

insulin like growth factor 2 mRNA binding protein 2, IMP-2, IMP2, IGF-II mRNA-binding protein 2, IGF2 mRNA-binding protein 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82757-2-PBS targets IGF2BP2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2142

Product name: Recombinant human IGF2BP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-341 aa of BC021290

Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 2
Calculated Molecular Weight65 kDa
Observed Molecular Weight55-65 kDa
GenBank Accession NumberBC021290
Gene Symbol IGF2BP2
Gene ID (NCBI) 10644
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6M1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990).

Loading...
||
New chat Able
正在加载,请稍候...