IGF2BP3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68470-1-Ig (same clone as 68470-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68470-1-Ig (IGF2BP3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68470-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68470-1-Ig (same clone as 68470-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68470-1-Ig (IGF2BP3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68470-1-PBS in a different storage buffer formulation.

IGF2BP3 Monoclonal Antibody for WB, ELISA

Cat No. 68470-1-PBS

Clone No.1G6A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

1G6A7, IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3

---

Product Information

68470-1-PBS targets IGF2BP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6349

  Product name: Recombinant human IGF2BP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 240-579 aa of BC065269

  Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

• Full Name: insulin-like growth factor 2 mRNA binding protein 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC065269
• Gene Symbol: IGF2BP3
• Gene ID (NCBI): 10643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00425
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IGF2BP3, also named as IMP3, KOC1 and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma.