IGF2BP3 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IGF2BP3 Monoclonal antibody, PBS Only (68470-1-PBS)

IGF2BP3 Monoclonal Antibody for WB, ELISA

Cat No. 68470-1-PBS Copied!

Clone No. 1G6A7

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

1G6A7, IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3

• 

  WB analysis using 68470-1-Ig (same clone as 68470-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68470-1-Ig (IGF2BP3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68470-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 68470-1-Ig (same clone as 68470-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68470-1-Ig (IGF2BP3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68470-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IGF2BP3 in ?

Chat with Able

---

Product Information

68470-1-PBS targets IGF2BP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6349

  Product name: Recombinant human IGF2BP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 240-579 aa of BC065269

  Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

• Full Name: insulin-like growth factor 2 mRNA binding protein 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC065269
• Gene Symbol: IGF2BP3
• Gene ID (NCBI): 10643
• RRID: AB_3085181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00425
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IGF2BP3, also named as IMP3, KOC1 and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma.

Publications

What published studies show

The IGF2BP3 Monoclonal antibody (1G6A7), catalog number 68470-1-PBS, has 1 citation. It appears in Functional & Integrative Genomics (2026), in a study on METTL14-mediated m6A modification of CXCL9 mRNA regulating macrophage polarization to suppress oral squamous cell carcinoma (OSCC) growth and stemness. The associated research fields include RNA modification (m6A), macrophage immunology, and head and neck oncology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Funct Integr Genomics; METTL14-mediated m6A modification of CXCL9 mRNA regulates macrophage CS polarization to suppress OSCC growth and stemness.; Authors - Bo Yang