IGF2BP3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81805-1-RR (same clone as 81805-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81805-1-RR (IGF2BP3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 81805-1-RR (same clone as 81805-1-PBS)

  WB result of IGF2BP3 antibody (81805-1-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IGF2BP3 transfected HeLa cells. This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 81805-1-RR (same clone as 81805-1-PBS)

  IP result of anti-IGF2BP3 (IP:81805-1-RR, 4ug; Detection:81805-1-RR 1:20000) with HeLa cells lysate 1280 ug. This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 81805-1-RR (same clone as 81805-1-PBS)

  IP result of anti-IGF2BP3 (IP:81805-1-RR, 4ug; Detection:81805-1-RR 1:4000) with HeLa cells lysate 1280 ug. This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical squamous cancer using 81805-1-RR (same clone as 81805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical squamous cancer tissue slide using 81805-1-RR (IGF2BP3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81805-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81805-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81805-1-RR against Human IGF2BP3 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

IGF2BP3 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 81805-1-PBS

Clone No.1L11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

1L11, IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3

---

Product Information

81805-1-PBS targets IGF2BP3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6226

  Product name: Recombinant human IGF2BP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 240-579 aa of BC065269

  Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

• Full Name: insulin-like growth factor 2 mRNA binding protein 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC065269
• Gene Symbol: IGF2BP3
• Gene ID (NCBI): 10643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00425
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.