• Featured Product
  • KD/KO Validated

IGF2BP3 Recombinant monoclonal antibody, PBS Only

IGF2BP3 Uni-rAb® Recombinant Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 81805-1-PBS
Clone No.1L11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

1L11, IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81805-1-PBS targets IGF2BP3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6226

Product name: Recombinant human IGF2BP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 240-579 aa of BC065269

Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 3
Calculated Molecular Weight 64 kDa
Observed Molecular Weight64 kDa
GenBank Accession NumberBC065269
Gene Symbol IGF2BP3
Gene ID (NCBI) 10643
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00425
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.

Loading...
||
New chat Able
正在加载,请稍候...