IGFBP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IGFBP1 Recombinant monoclonal antibody, PBS Only (83347-5-PBS)

IGFBP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83347-5-PBS Copied!

Clone No. 240263B9

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

240263B9, AFBP, hIGFBP 1, IBP 1, IBP1

• 

  WB analysis of HepG2 using 83347-5-RR (same clone as 83347-5-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 83347-5-RR (IGFBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83347-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 83347-5-RR (same clone as 83347-5-PBS)

  WB result of IGFBP1 antibody (83347-5-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IGFBP1 transfected HepG2 cells. This data was developed using the same antibody clone with 83347-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83347-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83347-5-RR against Human IGFBP1 were performed. The affinity constant is 40.6 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IGFBP1 in ?

Chat with Able

---

Product Information

83347-5-PBS targets IGFBP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0951

  Product name: Recombinant Human IGFBP-1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-259 aa of NM_000596.4

  Sequence: APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

• Full Name: IGF binding protein 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-35 kDa
• GenBank Accession Number: NM_000596.4
• Gene Symbol: IGFBP1
• Gene ID (NCBI): 3484
• RRID: AB_3671006
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P08833
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IGF-binding proteins (IGFBPs) family contains members like IGFBP-1, -2, -3, -4,-5 and-6. IGFBPs prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGF-I physically interacts with IGFBP-1 and that IGFBP-1 also binds to an integrin receptor, but the effect of IGFBP-1 on cell migration may be independent of IGF-I and is probably mediated through the alpha 5 beta 1 integrin. Transgenic mice models demonstrated that IGFBPs played important roles in the pathogenesis of obesity and INS resistance. Studies conducted in humans demonstrated the close relation between IGFBPs and the components of the metabolic syndrome.