IGFBP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• IGFBP1 Monoclonal antibody (60717-8-Ig)

IGFBP1 Monoclonal Antibody for WB, ELISA

Cat No. 60717-8-Ig

Clone No.4A9D2

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, ELISA

Synonyms

AFBP, hIGFBP 1, IBP 1, IBP1, IBP-1

• 

  WB analysis of human placenta using 60717-8-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 60717-8-Ig (IGFBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 60717-8-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 60717-8-Ig (IGFBP1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rabbit liver using 60717-8-Ig

  rabbit liver tissue were subjected to SDS PAGE followed by western blot with 60717-8-Ig (IGFBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60717-8-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60717-8-Ig (IGFBP1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, human placenta tissue, human plasma, rabbit liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60717-8-Ig targets IGFBP1 in WB, ELISA applications and shows reactivity with human, rabbit samples.

• Tested Reactivity: human, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0951

  Product name: Recombinant Human IGFBP-1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-259 aa of NM_000596.4

  Sequence: APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

• Full Name: IGF binding protein 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-35 kDa
• GenBank Accession Number: NM_000596.4
• Gene Symbol: IGFBP1
• Gene ID (NCBI): 3484
• RRID: AB_3743231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08833
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF-binding proteins (IGFBPs) family contains members like IGFBP-1, -2, -3, -4,-5 and-6. IGFBPs prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGF-I physically interacts with IGFBP-1 and that IGFBP-1 also binds to an integrin receptor, but the effect of IGFBP-1 on cell migration may be independent of IGF-I and is probably mediated through the alpha 5 beta 1 integrin. Transgenic mice models demonstrated that IGFBPs played important roles in the pathogenesis of obesity and INS resistance. Studies conducted in humans demonstrated the close relation between IGFBPs and the components of the metabolic syndrome.