Filter: AllWB

WB analysis using 30228-1-AP (same clone as 30228-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30228-1-AP (IGFBP7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30228-1-PBS in a different storage buffer formulation.

IGFBP7 Polyclonal antibody, PBS Only

Name: IGFBP7 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30228-1-PBS

IGFBP7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30228-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30228-1-PBS targets IGFBP7 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag33040 Product name: Recombinant human IGFBP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 181-282 aa of BC066339 Sequence: CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL Predict reactive species
Full Name	insulin-like growth factor binding protein 7
Calculated Molecular Weight	29 kDa
Observed Molecular Weight	32 kDa
GenBank Accession Number	BC066339
Gene Symbol	IGFBP7
Gene ID (NCBI)	3490
RRID	AB_3086269
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16270
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™