IGLC1 Monoclonal antibody, PBS Only (Capture)

IGLC1 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 67762-4-PBS
Clone No.2A3A10

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Human IgG lambda chain, IgG Lambda Light Chain, IGLC, Immunoglobulin lambda constant 1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67762-4-PBS targets IGLC1 as part of a matched antibody pair:

MP50274-2: 67762-4-PBS capture and 67762-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14783

Product name: Recombinant human IGLC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-234 aa of BC007782

Sequence: MAWTVLLLGLLSHCTGSGTSYVLTQPASVSVAPGQTARITCGGSNLGSKSVNWYQLRPGQAPILVVYENKERPAGIPERLSALTSEETATLTISSVVAGDEADYFCQVWDTTSQQYVFGTGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Predict reactive species
Full Name immunoglobulin lambda constant 1 (Mcg marker)
Calculated Molecular Weight 233 aa, 25 kDa
GenBank Accession NumberBC007782
Gene Symbol IgG Lambda Light Chain
Gene ID (NCBI) 3537
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A Magarose purification
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...