IGLV6-57 Polyclonal antibody

• 

  WB analysis using 18344-1-AP

  Human plasma was subjected to SDS PAGE followed by western blot with 18344-1-AP (IGLV6-57 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

IGLV6-57 Polyclonal Antibody for WB, ELISA

Cat No. 18344-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IGLV6 57, IGLV657, IGLV6-57, V1 22

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18344-1-AP targets IGLV6-57 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13141

  Product name: Recombinant human IGLV6-57 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-148 aa of BC023973

  Sequence: MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGRAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVLQTHGEVRQKLPRASLPGPVSACLHRRG

• Full Name: immunoglobulin lambda variable 6-57
• Calculated Molecular Weight: 148 aa, 16 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC023973
• Gene Symbol: IGLV6-57
• Gene ID (NCBI): 28778
• RRID: AB_2878534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.