Tested Applications
| Positive WB detected in | Jurkat cells, mouse brain tissue, rat brain tissue, rat lung tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15649-1-AP targets IKKB in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8191 Product name: Recombinant human IKBKB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC006231 Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS Predict reactive species |
| Full Name | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Calculated Molecular Weight | 756aa,81 kDa; 256aa,29 kDa |
| Observed Molecular Weight | 80 kDa, 86 kDa, 87 and 29 kDa |
| GenBank Accession Number | BC006231 |
| Gene Symbol | IKBKB |
| Gene ID (NCBI) | 3551 |
| RRID | AB_2122307 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14920 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. This antibody can identify 4 isoform of IKBKB with the molecular weight of 80, 86, 87 and 29 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IKKB antibody 15649-1-AP | Download protocol |
| IP protocol for IKKB antibody 15649-1-AP | Download protocol |
| WB protocol for IKKB antibody 15649-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IKKB polyclonal antibody (Cat# 15649-1-AP) has 154 citations spanning journals including Nature Metabolism, Nature Communications, EMBO Journal, Cell Molecular Immunology, Advanced Science, Pharmacological Research, International Immunopharmacology, FASEB Journal, and many others. Research fields encompass NF-κB signaling, inflammation, cancer, neuroinflammation, liver injury, metabolic disorders, cardiovascular disease, and pharmacology, with applications primarily in WB, IHC, IF, IP, and CoIP across human, mouse, rat, pig, and bovine species.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury | ||
Nat Metab MAPK signalling-induced phosphorylation and subcellular translocation of PDHE1α promotes tumour immune evasion. | ||
Cell Mol Immunol ACPAs promote IL-1β production in rheumatoid arthritis by activating the NLRP3 inflammasome. | ||
Nat Commun Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice | ||
ACS Nano Schwann Cell-Derived Exosomes and Methylprednisolone Composite Patch for Spinal Cord Injury Repair | ||
Redox Biol Cardioprotection of CAPE-oNO2 against myocardial ischemia/reperfusion induced ROS generation via regulating the SIRT1/eNOS/NF-κB pathway in vivo and in vitro. |
Reviews
What customers say
The single review for this antibody (rated 4/5) reports successful use in Western Blot at a 1:500 dilution on A549 lung cancer cells. The reviewer noted that the antibody produced a specific band as expected, though a couple of non-specific bands were also observed. Overall, the product performed well for its intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Eugenia (Verified Customer) (03-16-2022) | Antibody worked well with specific band although a couple of non-specific bands also appeared.
|
