Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12016-1-AP targets IKZF1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2631 Product name: Recombinant human IKZF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC018349 Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS Predict reactive species |
| Full Name | IKAROS family zinc finger 1 (Ikaros) |
| Calculated Molecular Weight | 477 aa, 53 kDa |
| Observed Molecular Weight | 50-70 kDa |
| GenBank Accession Number | BC018349 |
| Gene Symbol | IKZF1 |
| Gene ID (NCBI) | 10320 |
| RRID | AB_2124704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13422 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with 50-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IKZF1 antibody 12016-1-AP | Download protocol |
| WB protocol for IKZF1 antibody 12016-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IKZF1 Polyclonal antibody (catalog #12016-1-AP) has 16 citations. They appear in journals including Circulation Research, Journal of Experimental & Clinical Cancer Research, Journal of Medicinal Chemistry, European Journal of Medicinal Chemistry, Frontiers in Immunology, Cancers, Oncology Research, Molecular Oncology, British Journal of Haematology, Leukemia & Lymphoma, Medicine, and bioRxiv. Research fields span oncology (acute myeloid leukemia, multiple myeloma, neuroblastoma), PROTAC and molecular glue degrader discovery, immunology, epigenetics, and transcription factor biology.
| Species | Application | Title |
|---|---|---|
Circ Res A Novel Regulatory Mechanism of Smooth Muscle α-actin Expression by NRG-1/circACTA2/miR-548f-5p Axis. | ||
J Exp Clin Cancer Res GSPT1-specific protein degradation is effective in preclinical models of chemoresistant MYCN-amplified neuroblastoma. | ||
J Med Chem Discovery of the First-in-Class Protein Arginine Methyltransferase 1 PROTAC Degrader. | ||
J Med Chem Identification of XZ8078 as a Dual-Target Degrader Targeting PARP1 and IKZF3 for Broad Spectrum Anticancer Treatment. | ||
J Med Chem Discovery of Rigid Linker-Based IRAK4 PROTACs with Improved Metabolic Stability for the Treatment of Inflammatory Diseases. | ||
Front Immunol IKZF1 exacerbates the inflammatory response by epigenetically modulating mitochondrial function following acute peritonitis |
Reviews
What customers say
The product received a 4-star rating from a single review. The reviewer used the antibody at a 1:100 dilution for immunohistochemistry on zebrafish retina tissue, with no additional written comments provided. The overall feedback suggests satisfactory performance in IHC applications on zebrafish samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ryan (Verified Customer) (06-15-2018) |
 |
