• Featured Product
  • KD/KO Validated

IKZF1 Monoclonal antibody, PBS Only

IKZF1 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 66966-1-PBS
Clone No.1D6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, FC (Intra), Indirect ELISA

DNA binding protein Ikaros, DNA-binding protein Ikaros, hIk 1, Hs.54452, IK1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66966-1-PBS targets IKZF1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

Tested Reactivity human, mouse, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28637

Product name: Recombinant human IKZF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-303 aa of BC018349

Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS

Predict reactive species
Full Name IKAROS family zinc finger 1 (Ikaros)
Calculated Molecular Weight 477 aa, 53 kDa
Observed Molecular Weight 55-65 kDa
GenBank Accession NumberBC018349
Gene Symbol IKZF1
Gene ID (NCBI) 10320
RRIDAB_2882289
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13422
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.

Loading...
||
New chat Able
正在加载,请稍候...