IKZF5 Polyclonal antibody

• 

  WB analysis of Jurkat using 24780-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24780-1-AP (IKZF5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24780-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24780-1-AP (IKZF5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 24780-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24780-1-AP (IKZF5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 24780-1-AP

  IP result of anti-IKZF5 (IP:24780-1-AP, 4ug; Detection:24780-1-AP 1:300) with Jurkat cells lysate 2800ug.

IKZF5 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24780-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

IKZF5, PEGASUS, Zinc finger protein Pegasus, ZNFN1A5

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, HL-60 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24780-1-AP targets IKZF5 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20405

  Product name: Recombinant human IKZF5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 140-376 aa of BC022564

  Sequence: CELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSVVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSTQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPALPVQDPQLLHHCQHCDMYFADN

• Full Name: IKAROS family zinc finger 5 (Pegasus)
• Calculated Molecular Weight: 420 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC022564
• Gene Symbol: IKZF5
• Gene ID (NCBI): 64376
• RRID: AB_2879717
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5V7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.