• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IL-1 Beta Polyclonal antibody

IL-1 Beta Polyclonal Antibody for
Cat No. CL488-16806

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IL1 beta, Catabolin, IL 1, IL 1 beta, IL1 BETA, IL-1 beta, IL1- beta, IL1B, IL1beta, IL1F2, IL-1β, Interleukin 1 beta, interleukin 1, beta, Pro IL-1β

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-16806 targets IL-1 Beta in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10295

Product name: Recombinant human IL-1 beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-269 aa of BC008678

Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Predict reactive species
Full Name interleukin 1, beta
Calculated Molecular Weight 269 aa, 31 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberBC008678
Gene Symbol IL1B
Gene ID (NCBI) 3553
ENSEMBL Gene IDENSG00000125538
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01584
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.

Loading...
||
New chat Able
正在加载,请稍候...