IL-1 alpha Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL-1 alpha Polyclonal antibody (30216-1-AP)

• 

  WB analysis using 30216-1-AP

  LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 30216-1-AP (IL1-alpha antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

IL-1 alpha Polyclonal Antibody for WB, ELISA

Cat No. 30216-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Il1a, Il 1a, IL1 alpha, IL-1,IL1, IL1-alpha

---

Tested Applications

• Positive WB detected in: LPS treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30216-1-AP targets IL-1 alpha in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0263

  Product name: Recombinant mouse IL1-alpha protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 115-270 aa of NM_010554

  Sequence: MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

• Full Name: interleukin 1 alpha
• Calculated Molecular Weight: 31kd
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_010554
• Gene Symbol: Il1a
• Gene ID (NCBI): 16175
• RRID: AB_3742332
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01582
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.