Anti-Rat IL-1 alpha Rabbit Recombinant Antibody, PBS Only

IL-1 alpha Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98732-2-PBS
Clone No.251278D7

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

IL 1 alpha, IL-1,IL1, Il1a, IL-1A, IL-1alpha

Formulation:  PBS Only
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98732-2-PBS targets IL-1 alpha in FC (Intra) applications and shows reactivity with rat samples.

Tested Reactivity rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4641

Product name: Recombinant Rat IL-1 alpha protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 115-270 aa of NM_017019.1

Sequence: SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Predict reactive species
Full Name interleukin 1 alpha
Calculated Molecular Weight31kDa
GenBank Accession NumberNM_017019.1
Gene Symbol Il1a
Gene ID (NCBI) 24493
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16598
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL-1 alpha is a dual function cytokine that can function both as a transcription factor and a damage-associated molecular pattern (DAMP) in innate immune responses. It is expressed by many cell types and its expression is increased when cells are exposed to growth factors, pro-inflammatory, and stress-related signals. In its pro-form, IL-1 alpha contains a nuclear localization signal that allows it to translocate to the nucleus and bind to DNA, resulting in either the increase or prohibition of pro-inflammatory cytokine expression. When cells are exposed to necrotic signals, mature IL-1 alpha is released from the cell lysates and triggers a strong pro-inflammatory response upon binding to its receptor on nearby cells. Due to its strongly pro-inflammatory nature, IL-1 alpha has been linked to tumor metastasis and lower median survival in several cancers (PMID: 27434011, 29247995).

Loading...
||
New chat

Able

正在加载,请稍候...